Mouse Pcsk5 protein

Artikelnummer: BYT-ORB358112
Artikelname: Mouse Pcsk5 protein
Artikelnummer: BYT-ORB358112
Hersteller Artikelnummer: orb358112
Alternativnummer: BYT-ORB358112-20,BYT-ORB358112-100,BYT-ORB358112-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Proprotein convertase 5 , PC5Proprotein convertase 6 , PC6Subtilisin-like proprotein convertase 6 , SPC6Subtilisin/kexin-like protease PC5
This Mouse Pcsk5 protein spans the amino acid sequence from region 117-452aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 52.7 kDa
UniProt: Q04592
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DYDLSHAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAATANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKI
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Full length of Catalytic of His-SUMO-tag and expression region is 117-452aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.