Mouse Pcsk5 protein

Catalog Number: BYT-ORB358112
Article Name: Mouse Pcsk5 protein
Biozol Catalog Number: BYT-ORB358112
Supplier Catalog Number: orb358112
Alternative Catalog Number: BYT-ORB358112-20,BYT-ORB358112-100,BYT-ORB358112-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Proprotein convertase 5 , PC5Proprotein convertase 6 , PC6Subtilisin-like proprotein convertase 6 , SPC6Subtilisin/kexin-like protease PC5
This Mouse Pcsk5 protein spans the amino acid sequence from region 117-452aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 52.7 kDa
UniProt: Q04592
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DYDLSHAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAATANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKI
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Full length of Catalytic of His-SUMO-tag and expression region is 117-452aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.