Rat Socs3 protein

Artikelnummer: BYT-ORB358124
Artikelname: Rat Socs3 protein
Artikelnummer: BYT-ORB358124
Hersteller Artikelnummer: orb358124
Alternativnummer: BYT-ORB358124-20,BYT-ORB358124-100,BYT-ORB358124-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Cytokine-inducible SH2 protein 3
This Rat Socs3 protein spans the amino acid sequence from region 1-225aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 40.8 kDa
UniProt: O88583
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rattus norvegicus (Rat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: Full length of His-SUMO-tag and expression region is 1-225aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.