Rat Socs3 protein

Catalog Number: BYT-ORB358124
Article Name: Rat Socs3 protein
Biozol Catalog Number: BYT-ORB358124
Supplier Catalog Number: orb358124
Alternative Catalog Number: BYT-ORB358124-20,BYT-ORB358124-100,BYT-ORB358124-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cytokine-inducible SH2 protein 3
This Rat Socs3 protein spans the amino acid sequence from region 1-225aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 40.8 kDa
UniProt: O88583
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: Full length of His-SUMO-tag and expression region is 1-225aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.