Mouse Klk1b22 protein

Artikelnummer: BYT-ORB358147
Artikelname: Mouse Klk1b22 protein
Artikelnummer: BYT-ORB358147
Hersteller Artikelnummer: orb358147
Alternativnummer: BYT-ORB358147-20,BYT-ORB358147-100,BYT-ORB358147-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Beta-NGF-endopeptidase, Epidermal growth factor-binding protein type A , EGF-BP AGlandular kallikrein K22 , mGK-22Nerve growth factor beta chain endopeptidaseTissue kallikrein 22
This Mouse Klk1b22 protein spans the amino acid sequence from region 25-259aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 41.8 kDa
UniProt: P15948
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Full length of His-SUMO-tag and expression region is 25-259aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.