Mouse Klk1b22 protein

Catalog Number: BYT-ORB358147
Article Name: Mouse Klk1b22 protein
Biozol Catalog Number: BYT-ORB358147
Supplier Catalog Number: orb358147
Alternative Catalog Number: BYT-ORB358147-20,BYT-ORB358147-100,BYT-ORB358147-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Beta-NGF-endopeptidase, Epidermal growth factor-binding protein type A , EGF-BP AGlandular kallikrein K22 , mGK-22Nerve growth factor beta chain endopeptidaseTissue kallikrein 22
This Mouse Klk1b22 protein spans the amino acid sequence from region 25-259aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 41.8 kDa
UniProt: P15948
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Full length of His-SUMO-tag and expression region is 25-259aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.