Protozoa PPDK protein

Artikelnummer: BYT-ORB358156
Artikelname: Protozoa PPDK protein
Artikelnummer: BYT-ORB358156
Hersteller Artikelnummer: orb358156
Alternativnummer: BYT-ORB358156-20,BYT-ORB358156-100,BYT-ORB358156-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Pyruvate, orthophosphate dikinase
This Protozoa PPDK protein spans the amino acid sequence from region 1-342aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 54.4 kDa
UniProt: P37213
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Entamoeba histolytica
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MQRVYAFEDGDGTNKKLLGGKGAGLCTMTKIGLPVPQGFVITTEMCKQFIANGNKMPEGLMEEVKKEYQLVEKKSGKVFGGEENPLLVSVRSGAAMSMPGMMDTILNLGLNDKTVVALAKLTNNERFAYDSYRRFVSLFGKIALNACDEVYDKTLENKKVEKGVKLDTELDANDMKELAQVFIKKTEEFTKQPFPVDPYAQLEFAICAVFRSWMGKRAVDYRREFKITPEQADGTAVSVVSMVYGNMGNDSATGV
Anwendungsbeschreibung: Biological Origin: Entamoeba histolytica. Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.