Protozoa PPDK protein

Catalog Number: BYT-ORB358156
Article Name: Protozoa PPDK protein
Biozol Catalog Number: BYT-ORB358156
Supplier Catalog Number: orb358156
Alternative Catalog Number: BYT-ORB358156-20,BYT-ORB358156-100,BYT-ORB358156-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Pyruvate, orthophosphate dikinase
This Protozoa PPDK protein spans the amino acid sequence from region 1-342aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 54.4 kDa
UniProt: P37213
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Entamoeba histolytica
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MQRVYAFEDGDGTNKKLLGGKGAGLCTMTKIGLPVPQGFVITTEMCKQFIANGNKMPEGLMEEVKKEYQLVEKKSGKVFGGEENPLLVSVRSGAAMSMPGMMDTILNLGLNDKTVVALAKLTNNERFAYDSYRRFVSLFGKIALNACDEVYDKTLENKKVEKGVKLDTELDANDMKELAQVFIKKTEEFTKQPFPVDPYAQLEFAICAVFRSWMGKRAVDYRREFKITPEQADGTAVSVVSMVYGNMGNDSATGV
Application Notes: Biological Origin: Entamoeba histolytica. Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.