E. coli fkpA protein

Artikelnummer: BYT-ORB358164
Artikelname: E. coli fkpA protein
Artikelnummer: BYT-ORB358164
Hersteller Artikelnummer: orb358164
Alternativnummer: BYT-ORB358164-20,BYT-ORB358164-100,BYT-ORB358164-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Rotamase
This E. coli fkpA protein spans the amino acid sequence from region 26-270aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 42.3 kDa
UniProt: P65764
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AEAAKPATTADSKAAFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAPKADAKPEADAKAADSAKK
Anwendungsbeschreibung: Biological Origin: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) fkpA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) fkpA.