E. coli fkpA protein
Catalog Number:
BYT-ORB358164
- Images (3)
| Article Name: | E. coli fkpA protein |
| Biozol Catalog Number: | BYT-ORB358164 |
| Supplier Catalog Number: | orb358164 |
| Alternative Catalog Number: | BYT-ORB358164-20,BYT-ORB358164-100,BYT-ORB358164-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Rotamase |
| This E. coli fkpA protein spans the amino acid sequence from region 26-270aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 42.3 kDa |
| UniProt: | P65764 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AEAAKPATTADSKAAFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAPKADAKPEADAKAADSAKK |
| Application Notes: | Biological Origin: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC). Application Notes: This is His-SUMO-tag protein |



