Plant Ribosome-inactivating protein karasurin-C protein

Artikelnummer: BYT-ORB358276
Artikelname: Plant Ribosome-inactivating protein karasurin-C protein
Artikelnummer: BYT-ORB358276
Hersteller Artikelnummer: orb358276
Alternativnummer: BYT-ORB358276-1,BYT-ORB358276-100,BYT-ORB358276-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: rRNA N-glycosidase Cleaved into the following chain, Ribosome-inactivating protein karasurin-A
This Plant Ribosome-inactivating protein karasurin-C protein spans the amino acid sequence from region 22-270aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 29.4 kDa
UniProt: P24478
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EGDVSFRLSGATSSSYGVFISNLRKALPYERKLYDIPLLRSTLPGSQRYALIHLTNYADETISVAIDVTNVYVMGYRAGDTSYFFNEASATEAAKYVFKDAKRKVTLPYSGNYERLQIAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFETPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA
Anwendungsbeschreibung: Biological Origin: Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.