Plant Ribosome-inactivating protein karasurin-C protein

Catalog Number: BYT-ORB358276
Article Name: Plant Ribosome-inactivating protein karasurin-C protein
Biozol Catalog Number: BYT-ORB358276
Supplier Catalog Number: orb358276
Alternative Catalog Number: BYT-ORB358276-1,BYT-ORB358276-100,BYT-ORB358276-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: rRNA N-glycosidase Cleaved into the following chain, Ribosome-inactivating protein karasurin-A
This Plant Ribosome-inactivating protein karasurin-C protein spans the amino acid sequence from region 22-270aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 29.4 kDa
UniProt: P24478
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EGDVSFRLSGATSSSYGVFISNLRKALPYERKLYDIPLLRSTLPGSQRYALIHLTNYADETISVAIDVTNVYVMGYRAGDTSYFFNEASATEAAKYVFKDAKRKVTLPYSGNYERLQIAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFETPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA
Application Notes: Biological Origin: Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.