Reptile Kunitz-type neurotoxin MitTx-alpha protein

Artikelnummer: BYT-ORB358288
Artikelname: Reptile Kunitz-type neurotoxin MitTx-alpha protein
Artikelnummer: BYT-ORB358288
Hersteller Artikelnummer: orb358288
Alternativnummer: BYT-ORB358288-1,BYT-ORB358288-100,BYT-ORB358288-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Kunitz-type neurotoxin MitTx-alpha
This Reptile Kunitz-type neurotoxin MitTx-alpha protein spans the amino acid sequence from region 25-84aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 9.1 kDa
UniProt: G9I929
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Micrurus tener tener (Texas coral snake)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QIRPAFCYEDPPFFQKCGAFVDSYYFNRSRITCVHFFYGQCDVNQNHFTTMSECNRVCHG
Anwendungsbeschreibung: Biological Origin: Micrurus tener tener (Texas coral snake). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.