Reptile Kunitz-type neurotoxin MitTx-alpha protein

Catalog Number: BYT-ORB358288
Article Name: Reptile Kunitz-type neurotoxin MitTx-alpha protein
Biozol Catalog Number: BYT-ORB358288
Supplier Catalog Number: orb358288
Alternative Catalog Number: BYT-ORB358288-1,BYT-ORB358288-100,BYT-ORB358288-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Kunitz-type neurotoxin MitTx-alpha
This Reptile Kunitz-type neurotoxin MitTx-alpha protein spans the amino acid sequence from region 25-84aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 9.1 kDa
UniProt: G9I929
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Micrurus tener tener (Texas coral snake)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QIRPAFCYEDPPFFQKCGAFVDSYYFNRSRITCVHFFYGQCDVNQNHFTTMSECNRVCHG
Application Notes: Biological Origin: Micrurus tener tener (Texas coral snake). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.