Mouse Nus1 protein

Artikelnummer: BYT-ORB358304
Artikelname: Mouse Nus1 protein
Artikelnummer: BYT-ORB358304
Hersteller Artikelnummer: orb358304
Alternativnummer: BYT-ORB358304-1,BYT-ORB358304-100,BYT-ORB358304-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Di-trans,poly-cis-decaprenylcistransferaseCurated Nogo-B receptorBy similarity Short name, NgBRBy similarity Nuclear undecaprenyl pyrophosphate synthase 1 homolog
This Mouse Nus1 protein spans the amino acid sequence from region 24-120aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 13 kDa
UniProt: Q99LJ8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPRAVGRNRRHHRHPHGGPGPGPGPAATHPRLRWRADVRSLQKLPVHMGLLVTEEVQEPSFSD
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.