Mouse Nus1 protein

Catalog Number: BYT-ORB358304
Article Name: Mouse Nus1 protein
Biozol Catalog Number: BYT-ORB358304
Supplier Catalog Number: orb358304
Alternative Catalog Number: BYT-ORB358304-1,BYT-ORB358304-100,BYT-ORB358304-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Di-trans,poly-cis-decaprenylcistransferaseCurated Nogo-B receptorBy similarity Short name, NgBRBy similarity Nuclear undecaprenyl pyrophosphate synthase 1 homolog
This Mouse Nus1 protein spans the amino acid sequence from region 24-120aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 13 kDa
UniProt: Q99LJ8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPRAVGRNRRHHRHPHGGPGPGPGPAATHPRLRWRADVRSLQKLPVHMGLLVTEEVQEPSFSD
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.