Rat Plbd2 protein

Artikelnummer: BYT-ORB358316
Artikelname: Rat Plbd2 protein
Artikelnummer: BYT-ORB358316
Hersteller Artikelnummer: orb358316
Alternativnummer: BYT-ORB358316-1,BYT-ORB358316-100,BYT-ORB358316-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: LAMA-like protein 2 Lamina ancestor homolog 2 Phospholipase B domain-containing protein 2
This Rat Plbd2 protein spans the amino acid sequence from region 36-585aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 63.9 kDa
UniProt: Q4QQW8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rattus norvegicus (Rat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GALPTLGPGWRRQNPEPPASRTRSLLLDAASGQLRLEYGFHPDAVAWANLTNAIRETGWAYLDLGTNGSYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKSFLEANLEWMQREMELSPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFNIKPLGFLLLQISGDLEDLEPALNKTNTKPSVGSGSCSALIKLLPGSHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLIAG
Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.