Rat Plbd2 protein

Catalog Number: BYT-ORB358316
Article Name: Rat Plbd2 protein
Biozol Catalog Number: BYT-ORB358316
Supplier Catalog Number: orb358316
Alternative Catalog Number: BYT-ORB358316-1,BYT-ORB358316-100,BYT-ORB358316-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: LAMA-like protein 2 Lamina ancestor homolog 2 Phospholipase B domain-containing protein 2
This Rat Plbd2 protein spans the amino acid sequence from region 36-585aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 63.9 kDa
UniProt: Q4QQW8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GALPTLGPGWRRQNPEPPASRTRSLLLDAASGQLRLEYGFHPDAVAWANLTNAIRETGWAYLDLGTNGSYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKSFLEANLEWMQREMELSPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFNIKPLGFLLLQISGDLEDLEPALNKTNTKPSVGSGSCSALIKLLPGSHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLIAG
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.