Animal DCN protein

Artikelnummer: BYT-ORB358321
Artikelname: Animal DCN protein
Artikelnummer: BYT-ORB358321
Hersteller Artikelnummer: orb358321
Alternativnummer: BYT-ORB358321-1,BYT-ORB358321-100,BYT-ORB358321-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Bone proteoglycan II PG-S2
This Animal DCN protein spans the amino acid sequence from region 31-360aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 38.5 kDa
UniProt: P21793
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Bos taurus (Bovine)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DEASGIGPEEHFPEVPEIEPMGPVCPFRCQCHLRVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKV
Anwendungsbeschreibung: Biological Origin: Bos taurus (Bovine). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.