Animal DCN protein

Catalog Number: BYT-ORB358321
Article Name: Animal DCN protein
Biozol Catalog Number: BYT-ORB358321
Supplier Catalog Number: orb358321
Alternative Catalog Number: BYT-ORB358321-1,BYT-ORB358321-100,BYT-ORB358321-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Bone proteoglycan II PG-S2
This Animal DCN protein spans the amino acid sequence from region 31-360aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 38.5 kDa
UniProt: P21793
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Bos taurus (Bovine)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DEASGIGPEEHFPEVPEIEPMGPVCPFRCQCHLRVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKV
Application Notes: Biological Origin: Bos taurus (Bovine). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.