Fish mt2 protein

Artikelnummer: BYT-ORB358322
Artikelname: Fish mt2 protein
Artikelnummer: BYT-ORB358322
Hersteller Artikelnummer: orb358322
Alternativnummer: BYT-ORB358322-1,BYT-ORB358322-100,BYT-ORB358322-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: MT-2
This Fish mt2 protein spans the amino acid sequence from region 1-60aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 8 kDa
UniProt: Q7ZSY6
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Danio rerio (Zebrafish) (Brachydanio rerio)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDPCECAKTGTCNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGSSCCQ
Anwendungsbeschreibung: Biological Origin: Danio rerio (Zebrafish) (Brachydanio rerio). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.