Fish mt2 protein

Catalog Number: BYT-ORB358322
Article Name: Fish mt2 protein
Biozol Catalog Number: BYT-ORB358322
Supplier Catalog Number: orb358322
Alternative Catalog Number: BYT-ORB358322-1,BYT-ORB358322-100,BYT-ORB358322-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: MT-2
This Fish mt2 protein spans the amino acid sequence from region 1-60aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 8 kDa
UniProt: Q7ZSY6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Danio rerio (Zebrafish) (Brachydanio rerio)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDPCECAKTGTCNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGSSCCQ
Application Notes: Biological Origin: Danio rerio (Zebrafish) (Brachydanio rerio). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.