Pig NGF protein

Artikelnummer: BYT-ORB358340
Artikelname: Pig NGF protein
Artikelnummer: BYT-ORB358340
Hersteller Artikelnummer: orb358340
Alternativnummer: BYT-ORB358340-1,BYT-ORB358340-100,BYT-ORB358340-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Beta-NGF
This Pig NGF protein spans the amino acid sequence from region 110-229aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 29.4 kDa
UniProt: Q29074
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Sus scrofa (Pig)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SSSHPVFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAGRRA
Anwendungsbeschreibung: Biological Origin: Sus scrofa (Pig). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.