Pig NGF protein

Catalog Number: BYT-ORB358340
Article Name: Pig NGF protein
Biozol Catalog Number: BYT-ORB358340
Supplier Catalog Number: orb358340
Alternative Catalog Number: BYT-ORB358340-1,BYT-ORB358340-100,BYT-ORB358340-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Beta-NGF
This Pig NGF protein spans the amino acid sequence from region 110-229aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 29.4 kDa
UniProt: Q29074
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Sus scrofa (Pig)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SSSHPVFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAGRRA
Application Notes: Biological Origin: Sus scrofa (Pig). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.