E. coli PTH protein

Artikelnummer: BYT-ORB358343
Artikelname: E. coli PTH protein
Artikelnummer: BYT-ORB358343
Hersteller Artikelnummer: orb358343
Alternativnummer: BYT-ORB358343-1,BYT-ORB358343-100,BYT-ORB358343-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: hPTH protein, Parathormone protein, Parathyrin protein, Parathyroid hormone 1 protein, Parathyroid hormone protein, PTH protein, PTH1 protein, PTH1 receptor protein, PTH1R protein, PTHR protein, PTHR1 protein, PTHY_HUMAN protein.
This E. coli PTH protein spans the amino acid sequence from region 1-194aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 25.1 kDa
UniProt: P0A7D1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli (strain K12)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MTIKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAARCTEMWFTDGLTKATNRLHAFKAQ
Anwendungsbeschreibung: Biological Origin: Escherichia coli (strain K12). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.