E. coli PTH protein

Catalog Number: BYT-ORB358343
Article Name: E. coli PTH protein
Biozol Catalog Number: BYT-ORB358343
Supplier Catalog Number: orb358343
Alternative Catalog Number: BYT-ORB358343-1,BYT-ORB358343-100,BYT-ORB358343-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: hPTH protein, Parathormone protein, Parathyrin protein, Parathyroid hormone 1 protein, Parathyroid hormone protein, PTH protein, PTH1 protein, PTH1 receptor protein, PTH1R protein, PTHR protein, PTHR1 protein, PTHY_HUMAN protein.
This E. coli PTH protein spans the amino acid sequence from region 1-194aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 25.1 kDa
UniProt: P0A7D1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Escherichia coli (strain K12)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTIKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAARCTEMWFTDGLTKATNRLHAFKAQ
Application Notes: Biological Origin: Escherichia coli (strain K12). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.