Bacterial acpS protein
Artikelnummer:
BYT-ORB358363
- Bilder (3)
| Artikelname: | Bacterial acpS protein |
| Artikelnummer: | BYT-ORB358363 |
| Hersteller Artikelnummer: | orb358363 |
| Alternativnummer: | BYT-ORB358363-1,BYT-ORB358363-100,BYT-ORB358363-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | 4-phosphopantetheinyl transferase AcpS |
| This Bacterial acpS protein spans the amino acid sequence from region 1-119aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 29.6 kDa |
| UniProt: | Q6GF02 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Staphylococcus aureus (strain MRSA252) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MIHGIGVDLIEIDRIKVLYSKQPKLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEAFSKALGTGLGKHVAFNDIDCYNDELGKPKIDYEGFIVHVSISHTEHYAMSQVVLEKSAF |
| Anwendungsbeschreibung: | Biological Origin: Staphylococcus aureus (strain MRSA252). Application Notes: This is His-SUMO-tag protein |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain MRSA252) acpS. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain MRSA252) acpS. |
Produktgarantie und fachkundiger Support
