Bacterial acpS protein
Catalog Number:
BYT-ORB358363
- Images (3)
| Article Name: | Bacterial acpS protein |
| Biozol Catalog Number: | BYT-ORB358363 |
| Supplier Catalog Number: | orb358363 |
| Alternative Catalog Number: | BYT-ORB358363-1,BYT-ORB358363-100,BYT-ORB358363-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | 4-phosphopantetheinyl transferase AcpS |
| This Bacterial acpS protein spans the amino acid sequence from region 1-119aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 29.6 kDa |
| UniProt: | Q6GF02 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Staphylococcus aureus (strain MRSA252) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MIHGIGVDLIEIDRIKVLYSKQPKLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEAFSKALGTGLGKHVAFNDIDCYNDELGKPKIDYEGFIVHVSISHTEHYAMSQVVLEKSAF |
| Application Notes: | Biological Origin: Staphylococcus aureus (strain MRSA252). Application Notes: This is His-SUMO-tag protein |



