Insect Oxyopinin-4a protein

Artikelnummer: BYT-ORB358402
Artikelname: Insect Oxyopinin-4a protein
Artikelnummer: BYT-ORB358402
Hersteller Artikelnummer: orb358402
Alternativnummer: BYT-ORB358402-20,BYT-ORB358402-100,BYT-ORB358402-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Oxt-4a
This Insect Oxyopinin-4a protein spans the amino acid sequence from region 48-77aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 19.6 kDa
UniProt: F8J4S0
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Oxyopes takobius (Lynx spider) (Oxyopes foliiformis)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GIRCPKSWKCKAFKQRVLKRLLAMLRQHAF
Anwendungsbeschreibung: Biological Origin: Oxyopes takobius (Lynx spider) (Oxyopes foliiformis). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.