Insect Oxyopinin-4a protein

Catalog Number: BYT-ORB358402
Article Name: Insect Oxyopinin-4a protein
Biozol Catalog Number: BYT-ORB358402
Supplier Catalog Number: orb358402
Alternative Catalog Number: BYT-ORB358402-20,BYT-ORB358402-100,BYT-ORB358402-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Oxt-4a
This Insect Oxyopinin-4a protein spans the amino acid sequence from region 48-77aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 19.6 kDa
UniProt: F8J4S0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Oxyopes takobius (Lynx spider) (Oxyopes foliiformis)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GIRCPKSWKCKAFKQRVLKRLLAMLRQHAF
Application Notes: Biological Origin: Oxyopes takobius (Lynx spider) (Oxyopes foliiformis). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.