E. coli lepB protein

Artikelnummer: BYT-ORB358413
Artikelname: E. coli lepB protein
Artikelnummer: BYT-ORB358413
Hersteller Artikelnummer: orb358413
Alternativnummer: BYT-ORB358413-20,BYT-ORB358413-100,BYT-ORB358413-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Leader peptidase I
This E. coli lepB protein spans the amino acid sequence from region 78-324aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 43.7 kDa
UniProt: P00803
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli (strain K12)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDKQEGEWPTGLRLSRIGGIH
Anwendungsbeschreibung: Biological Origin: Escherichia coli (strain K12). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.