E. coli lepB protein

Catalog Number: BYT-ORB358413
Article Name: E. coli lepB protein
Biozol Catalog Number: BYT-ORB358413
Supplier Catalog Number: orb358413
Alternative Catalog Number: BYT-ORB358413-20,BYT-ORB358413-100,BYT-ORB358413-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Leader peptidase I
This E. coli lepB protein spans the amino acid sequence from region 78-324aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 43.7 kDa
UniProt: P00803
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Escherichia coli (strain K12)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDKQEGEWPTGLRLSRIGGIH
Application Notes: Biological Origin: Escherichia coli (strain K12). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.