Mouse At3g57050 protein

Artikelnummer: BYT-ORB358425
Artikelname: Mouse At3g57050 protein
Artikelnummer: BYT-ORB358425
Hersteller Artikelnummer: orb358425
Alternativnummer: BYT-ORB358425-20,BYT-ORB358425-100,BYT-ORB358425-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Short name, CBL Alternative name(s), Beta-cystathionase Cysteine lyase
This Mouse At3g57050 protein spans the amino acid sequence from region 70-464aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 46.9 kDa
UniProt: P53780
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Arabidopsis thaliana (Mouse-ear cress)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NNTTDSLNTMNIKEEASVSTLLVNLDNKFDPFDAMSTPLYQTATFKQPSAIENGPYDYTRSGNPTRDALESLLAKLDKADRAFCFTSGMAALSAVTHLIKNGEEIVAGDDVYGGSDRLLSQVVPRSGVVVKRVNTTKLDEVAAAIGPQTKLVWLESPTNPRQQISDIRKISEMAHAQGALVLVDNSIMSPVLSRPLELGADIVMHSATKFIAGHSDVMAGVLAVKGEKLAKEVYFLQNSEGSGLAPFDCWLCLRG
Anwendungsbeschreibung: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.