Mouse At3g57050 protein

Catalog Number: BYT-ORB358425
Article Name: Mouse At3g57050 protein
Biozol Catalog Number: BYT-ORB358425
Supplier Catalog Number: orb358425
Alternative Catalog Number: BYT-ORB358425-20,BYT-ORB358425-100,BYT-ORB358425-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Short name, CBL Alternative name(s), Beta-cystathionase Cysteine lyase
This Mouse At3g57050 protein spans the amino acid sequence from region 70-464aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 46.9 kDa
UniProt: P53780
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Arabidopsis thaliana (Mouse-ear cress)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: NNTTDSLNTMNIKEEASVSTLLVNLDNKFDPFDAMSTPLYQTATFKQPSAIENGPYDYTRSGNPTRDALESLLAKLDKADRAFCFTSGMAALSAVTHLIKNGEEIVAGDDVYGGSDRLLSQVVPRSGVVVKRVNTTKLDEVAAAIGPQTKLVWLESPTNPRQQISDIRKISEMAHAQGALVLVDNSIMSPVLSRPLELGADIVMHSATKFIAGHSDVMAGVLAVKGEKLAKEVYFLQNSEGSGLAPFDCWLCLRG
Application Notes: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.