Reptile Toxin MIT1 protein

Artikelnummer: BYT-ORB358434
Artikelname: Reptile Toxin MIT1 protein
Artikelnummer: BYT-ORB358434
Hersteller Artikelnummer: orb358434
Alternativnummer: BYT-ORB358434-20,BYT-ORB358434-100,BYT-ORB358434-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Short name, MIT 1 Alternative name(s), Black mamba intestinal toxin 1 Black mamba venom protein A
This Reptile Toxin MIT1 protein spans the amino acid sequence from region 1-81aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 24.6 kDa
UniProt: P25687
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Dendroaspis polylepis polylepis (Black mamba)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSKS
Anwendungsbeschreibung: Biological Origin: Dendroaspis polylepis polylepis (Black mamba). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.