Reptile Toxin MIT1 protein

Catalog Number: BYT-ORB358434
Article Name: Reptile Toxin MIT1 protein
Biozol Catalog Number: BYT-ORB358434
Supplier Catalog Number: orb358434
Alternative Catalog Number: BYT-ORB358434-20,BYT-ORB358434-100,BYT-ORB358434-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Short name, MIT 1 Alternative name(s), Black mamba intestinal toxin 1 Black mamba venom protein A
This Reptile Toxin MIT1 protein spans the amino acid sequence from region 1-81aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 24.6 kDa
UniProt: P25687
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Dendroaspis polylepis polylepis (Black mamba)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSKS
Application Notes: Biological Origin: Dendroaspis polylepis polylepis (Black mamba). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.