Bacterial mecA protein

Artikelnummer: BYT-ORB358825
Artikelname: Bacterial mecA protein
Artikelnummer: BYT-ORB358825
Hersteller Artikelnummer: orb358825
Alternativnummer: BYT-ORB358825-20,BYT-ORB358825-100,BYT-ORB358825-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: mecA, MW0880Adapter protein MecA
This Bacterial mecA protein spans the amino acid sequence from region 1-239aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 44.3 kDa
UniProt: P60186
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Staphylococcus aureus (strain MW2)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE
Anwendungsbeschreibung: Biological Origin: Staphylococcus aureus (strain MW2). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain MW2) mecA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain MW2) mecA.