Bacterial mecA protein

Catalog Number: BYT-ORB358825
Article Name: Bacterial mecA protein
Biozol Catalog Number: BYT-ORB358825
Supplier Catalog Number: orb358825
Alternative Catalog Number: BYT-ORB358825-20,BYT-ORB358825-100,BYT-ORB358825-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: mecA, MW0880Adapter protein MecA
This Bacterial mecA protein spans the amino acid sequence from region 1-239aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 44.3 kDa
UniProt: P60186
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Staphylococcus aureus (strain MW2)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE
Application Notes: Biological Origin: Staphylococcus aureus (strain MW2). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain MW2) mecA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain MW2) mecA.