Mouse Loxl4 protein
Artikelnummer:
BYT-ORB358896
- Bilder (3)
| Artikelname: | Mouse Loxl4 protein |
| Artikelnummer: | BYT-ORB358896 |
| Hersteller Artikelnummer: | orb358896 |
| Alternativnummer: | BYT-ORB358896-20,BYT-ORB358896-100,BYT-ORB358896-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Lysyl oxidase-like protein 4 Lysyl oxidase-related protein C |
| This Mouse Loxl4 protein spans the amino acid sequence from region 26-757aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 85.9 kDa |
| UniProt: | Q924C6 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mus musculus (Mouse) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | QSSGTKKLRLVGPTDRPEEGRLEVLHQGQWGTVCDDDFALQEATVACRQLGFESALTWAHSAKYGQGEGPIWLDNVRCLGTEKTLDQCGSNGWGVSDCRHSEDVGVVCHPRRQHGYHSEKVSNALGPQGRRLEEVRLKPILASAKRHSPVTEGAVEVRYDGHWRQVCDQGWTMNNSRVVCGMLGFPSQTSVNSHYYRKVWNLKMKDPKSRLNSLTKKNSFWIHRVDCLGTEPHLAKCQVQVAPGRGKLRPACPGG |
| Anwendungsbeschreibung: | Biological Origin: Mus musculus (Mouse). Application Notes: This is His-tag protein |



