Mouse Loxl4 protein

Catalog Number: BYT-ORB358896
Article Name: Mouse Loxl4 protein
Biozol Catalog Number: BYT-ORB358896
Supplier Catalog Number: orb358896
Alternative Catalog Number: BYT-ORB358896-20,BYT-ORB358896-100,BYT-ORB358896-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Lysyl oxidase-like protein 4 Lysyl oxidase-related protein C
This Mouse Loxl4 protein spans the amino acid sequence from region 26-757aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 85.9 kDa
UniProt: Q924C6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QSSGTKKLRLVGPTDRPEEGRLEVLHQGQWGTVCDDDFALQEATVACRQLGFESALTWAHSAKYGQGEGPIWLDNVRCLGTEKTLDQCGSNGWGVSDCRHSEDVGVVCHPRRQHGYHSEKVSNALGPQGRRLEEVRLKPILASAKRHSPVTEGAVEVRYDGHWRQVCDQGWTMNNSRVVCGMLGFPSQTSVNSHYYRKVWNLKMKDPKSRLNSLTKKNSFWIHRVDCLGTEPHLAKCQVQVAPGRGKLRPACPGG
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Loxl4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Loxl4.