Human RYR3 protein

Artikelnummer: BYT-ORB382969
Artikelname: Human RYR3 protein
Artikelnummer: BYT-ORB382969
Hersteller Artikelnummer: orb382969
Alternativnummer: BYT-ORB382969-20,BYT-ORB382969-100,BYT-ORB382969-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Brain ryanodine receptor-calcium release channelBrain-type ryanodine receptorType 3 ryanodine receptor
This Human RYR3 protein spans the amino acid sequence from region 3934-4181aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 32.5 kDa
UniProt: Q15413
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DGKGIISKKEFQKAMEGQKQYTQSEIDFLLSCAEADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQISESDSADRPEEEEEDEDSSYVLEIAGEEEEDGSLEPASAFAMACASVKRNVTDFLKRATLKNLRKQYRNVKKMTAKELV
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.