Human RYR3 protein

Catalog Number: BYT-ORB382969
Article Name: Human RYR3 protein
Biozol Catalog Number: BYT-ORB382969
Supplier Catalog Number: orb382969
Alternative Catalog Number: BYT-ORB382969-20,BYT-ORB382969-100,BYT-ORB382969-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Brain ryanodine receptor-calcium release channelBrain-type ryanodine receptorType 3 ryanodine receptor
This Human RYR3 protein spans the amino acid sequence from region 3934-4181aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 32.5 kDa
UniProt: Q15413
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DGKGIISKKEFQKAMEGQKQYTQSEIDFLLSCAEADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQISESDSADRPEEEEEDEDSSYVLEIAGEEEEDGSLEPASAFAMACASVKRNVTDFLKRATLKNLRKQYRNVKKMTAKELV
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.