Human C1QTNF3 protein

Artikelnummer: BYT-ORB382987
Artikelname: Human C1QTNF3 protein
Artikelnummer: BYT-ORB382987
Hersteller Artikelnummer: orb382987
Alternativnummer: BYT-ORB382987-20,BYT-ORB382987-100,BYT-ORB382987-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Collagenous repeat-containing sequence 26KDA protein , CORS26Secretory protein CORS26
This Human C1QTNF3 protein spans the amino acid sequence from region 23-246aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 28.2 kDa
UniProt: Q9BXJ4
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.