Human C1QTNF3 protein

Catalog Number: BYT-ORB382987
Article Name: Human C1QTNF3 protein
Biozol Catalog Number: BYT-ORB382987
Supplier Catalog Number: orb382987
Alternative Catalog Number: BYT-ORB382987-20,BYT-ORB382987-100,BYT-ORB382987-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Collagenous repeat-containing sequence 26KDA protein , CORS26Secretory protein CORS26
This Human C1QTNF3 protein spans the amino acid sequence from region 23-246aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 28.2 kDa
UniProt: Q9BXJ4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.