Bacterial Streptavidin protein

Artikelnummer: BYT-ORB383014
Artikelname: Bacterial Streptavidin protein
Artikelnummer: BYT-ORB383014
Hersteller Artikelnummer: orb383014
Alternativnummer: BYT-ORB383014-20,BYT-ORB383014-100,BYT-ORB383014-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Streptavidin
This Bacterial Streptavidin protein spans the amino acid sequence from region 25-183aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 18.5 kDa
UniProt: P22629
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Streptomyces avidinii
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
Anwendungsbeschreibung: Biological Origin: Streptomyces avidinii. Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.