Bacterial Streptavidin protein

Catalog Number: BYT-ORB383014
Article Name: Bacterial Streptavidin protein
Biozol Catalog Number: BYT-ORB383014
Supplier Catalog Number: orb383014
Alternative Catalog Number: BYT-ORB383014-20,BYT-ORB383014-100,BYT-ORB383014-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Streptavidin
This Bacterial Streptavidin protein spans the amino acid sequence from region 25-183aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 18.5 kDa
UniProt: P22629
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Streptomyces avidinii
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
Application Notes: Biological Origin: Streptomyces avidinii. Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.