Parasite MSA2 protein

Artikelnummer: BYT-ORB383015
Artikelname: Parasite MSA2 protein
Artikelnummer: BYT-ORB383015
Hersteller Artikelnummer: orb383015
Alternativnummer: BYT-ORB383015-20,BYT-ORB383015-100,BYT-ORB383015-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 45KDA merozoite surface antigen
This Parasite MSA2 protein spans the amino acid sequence from region 109-246aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 16.7 kDa
UniProt: P50498
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Plasmodium falciparum (isolate 3D7)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNN
Anwendungsbeschreibung: Biological Origin: Plasmodium falciparum (isolate 3D7). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.