Parasite MSA2 protein

Catalog Number: BYT-ORB383015
Article Name: Parasite MSA2 protein
Biozol Catalog Number: BYT-ORB383015
Supplier Catalog Number: orb383015
Alternative Catalog Number: BYT-ORB383015-20,BYT-ORB383015-100,BYT-ORB383015-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: 45KDA merozoite surface antigen
This Parasite MSA2 protein spans the amino acid sequence from region 109-246aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 16.7 kDa
UniProt: P50498
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Plasmodium falciparum (isolate 3D7)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: NDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNN
Application Notes: Biological Origin: Plasmodium falciparum (isolate 3D7). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.