Human SIRPB1 protein

Artikelnummer: BYT-ORB383029
Artikelname: Human SIRPB1 protein
Artikelnummer: BYT-ORB383029
Hersteller Artikelnummer: orb383029
Alternativnummer: BYT-ORB383029-1, BYT-ORB383029-100, BYT-ORB383029-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Signal-regulatory protein beta-1 Short name, SIRP-beta-1 Alternative name(s), CD172 antigen-like family member B CD_antigen, CD172b
This Human SIRPB1 protein spans the amino acid sequence from region 30-371aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 41.3 kDa
UniProt: O00241
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSVSYSIHSTARVVLTRGDVHSQVICEIAHITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSNFYPRGLQL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.