Human SIRPB1 protein

Catalog Number: BYT-ORB383029
Article Name: Human SIRPB1 protein
Biozol Catalog Number: BYT-ORB383029
Supplier Catalog Number: orb383029
Alternative Catalog Number: BYT-ORB383029-1, BYT-ORB383029-100, BYT-ORB383029-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Signal-regulatory protein beta-1 Short name, SIRP-beta-1 Alternative name(s), CD172 antigen-like family member B CD_antigen, CD172b
This Human SIRPB1 protein spans the amino acid sequence from region 30-371aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 41.3 kDa
UniProt: O00241
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSVSYSIHSTARVVLTRGDVHSQVICEIAHITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSNFYPRGLQL
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.